LL-37 (5mg) Lot L375N070725: Certificate of Analysis (COA)
Paramount Peptides · tested Jul 16, 2025 by Janoshik · Most recent COA
This page summarizes the third-party lab report for lot L375N070725 of LL-37 (5mg) sold by Paramount Peptides. The lot number on this page should match the lot printed on the vial label. Don't rely on this summary alone: use the button to open the lab's own record and compare the lot, date and results.
LL-37 (5mg) lot L375N070725 test results, explained
Every result printed on this certificate, as reported by Janoshik, with a plain-English note on what the test measures. "Pass" and "specification" wording comes from the certificate; where the lab prints no pass/fail, we say so.
| Test | Result on the certificate | What it measures | This lot |
|---|---|---|---|
| HPLC purity | 99.268% · Per vial: 99.394%; 99.268%; 99.459% (lowest, 99.268%, shown) | HPLC separates the sample into its components; purity is the share of the detected signal that sits in the main peak. On its own it doesn't show which molecule that peak is. That's what the identity test is for. | No pass/fail printed; reported value at or above 98% |
| Identity | Not reported | This certificate doesn't report an identity test, so it doesn't confirm which molecule is in the vial. Purity and quantity alone can't tell you that. | Not tested on this certificate |
| Quantity (measured content) | LL-37 5.50 mg; 5.48 mg; 5.46 mg. | How much peptide the lab measured in the vial, compared with the amount printed on the label. | Reported |
Lot and report details
| Lot / batch number | L375N070725 |
|---|---|
| Product (as labeled by vendor) | LL-37 (5mg) |
| Labeled vial size | 5 mg |
| Testing laboratory | Janoshik |
| Tests requested | Assessment of a peptide vial or vials |
| Testing ordered | Jul 12, 2025 |
| Sample received by lab | Jul 15, 2025 |
| Report date | Jul 16, 2025 |
| Task number + unique key | Task #71257, key TX45NV59TW42 |
| Lab-record check | Not checked automatically. Open the lab's record to compare. |
| Vendor | Paramount Peptides |
| Verify | Open Janoshik's record ↗ |
The certificate itself
About Janoshik
An independent analytical lab based in Prague, Czech Republic (Janoshik s.r.o.). Each report carries a task number and a unique verification key.
Accreditation: No accreditation is printed on these reports, and we found no published ISO/IEC 17025 accreditation for the lab (checked Oct 7, 2026).
Tests: On the reports here: HPLC purity and the measured content per vial. Other tests appear only when they're listed under Results.
How to verify: Go to janoshik.com/verify and enter the unique key printed on the report (the report's QR code links there too). Janoshik blocks automated checks, so we haven't matched these records ourselves.
Open Janoshik's record ↗Lab info from: janoshik.com · checked Oct 7, 2026.
Compound reference: LL-37
- Also called
- cathelicidin LL-37; human cathelicidin antimicrobial peptide
- Sequence
- [LL-37, 37 aa] (37 residues)
- Formula
- C205H340N60O53
- Mol. weight
- 4493 g/mol
- CAS
- 154947-66-7
- Source
- PubChem CID 16198951 ↗
A 37-residue peptide, the active fragment of the human cathelicidin protein. Reference data only; it describes the molecule, not any use of it. For laboratory research use only.
LL-37 (5mg) lot history at Paramount Peptides
All 2 certificates we have for this product from Paramount Peptides, newest first. The chart plots HPLC purity by report date (lots without a purity figure are left out). This lot is highlighted.
| Lot | Report date | Lab | HPLC purity |
|---|---|---|---|
| L375N070725 | Jul 16, 2025 | Janoshik | 99.27% |
| LL375A061125 | Jun 19, 2025 | Janoshik | 99.74% |
Also available from Peptira
LL-37 is also carried by Peptira, our other tested supplier. These are the most recent LL-37 certificates we have from them; each links to its own lot page.
| Product | Lot | Report date | Lab | HPLC purity |
|---|---|---|---|---|
| LL-37 Vial 5 mg | LL37-5-002 | Jan 31, 2026 | Freedom Diagnostics | 99.93% |
| LL-37 Vial 5 mg | LL37-5-001 | Dec 26, 2025 | Freedom Diagnostics | 99.79% |
Where to get lab-tested LL-37: products, sizes and latest COAs →
What to check on your vial
- The lot number on the vial label reads L375N070725, character for character.
- The product name and vial size on the label match LL-37 (5mg) (5 mg).
- The lab's own record (www.janoshik.com, code Task #71257, key TX45NV59TW42) shows the same lot, report date (Jul 16, 2025) and results as this page.
- The report date is a date you'd expect for your purchase: a much older certificate may belong to an earlier lot.
- The identity line names the compound you expect. If it's "Not reported", the certificate doesn't confirm which molecule is in the vial.
- The certificate is a clean document: no mismatched fonts, edited numbers or a missing verification code.
How to check this COA in under a minute
- Find the lot number on your vial label and confirm it reads L375N070725.
- Open Janoshik's record with the button above, or go to www.janoshik.com and enter Task #71257, key TX45NV59TW42.
- Compare the lot number, test date, purity and identity result with the table above. They should be identical.
- New to COAs? Read How to read a peptide COA for what HPLC purity and mass spec identity mean.
Questions about lot L375N070725
What HPLC purity did LL-37 (5mg) lot L375N070725 test at?
Janoshik reported 99.27% HPLC purity for lot L375N070725 in a report dated Jul 16, 2025.
How do I verify the COA for lot L375N070725?
Go to www.janoshik.com and enter the task number + unique key Task #71257, key TX45NV59TW42. The lab's own record should show lot L375N070725 with the same dates and results as this page.
Is lot L375N070725 the newest LL-37 (5mg) lot from Paramount Peptides?
It's the most recent LL-37 (5mg) certificate we have on file from Paramount Peptides as of Oct 8, 2026. Vendors can ship a newer lot before its certificate is posted, so check your vial label.
Does this certificate apply to my vial?
Only if the lot number printed on your vial reads L375N070725 exactly. A certificate of analysis covers one lot; it says nothing about other lots of the same product.
Other lots and COAs
LL-37 (5mg) at Paramount Peptides
Lab-tested lot L375N070725 · 99.27% HPLC purity · Janoshik
Affiliate disclosure: We earn a commission if you buy through the vendor links on this page, at no extra cost to you. Peptides & Coffee is an independent COA reference and is not owned by or affiliated with the vendors or labs listed. Lab results are published by the vendors and labs; we link to each lab's own verification record so you can check them yourself. Stock and lots change: the vendor may be shipping a newer lot than the one on this page, so check your vial label.